![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (30 species) not a true protein |
![]() | Species Bullfrog (Rana catesbeiana) [TaxId:8400] [189485] (19 PDB entries) |
![]() | Domain d4p18j_: 4p18 J: [263394] automated match to d3shxa_ complexed with act, cl, edo, so4; mutant |
PDB Entry: 4p18 (more details), 1.91 Å
SCOPe Domain Sequences for d4p18j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p18j_ a.25.1.1 (J:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]} vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere haekfmkyqnkrggrvvlqkikkperdewgntleamqaalqlektvnqalldlhklatdk vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
Timeline for d4p18j_: