| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d4ozhg2: 4ozh G:130-217 [263387] Other proteins in same PDB: d4ozha1, d4ozhb1, d4ozhb2, d4ozhc1, d4ozhd1, d4ozhd2, d4ozhe1, d4ozhf1, d4ozhg1, d4ozhh1 automated match to d2esvd2 complexed with ca, nag |
PDB Entry: 4ozh (more details), 2.8 Å
SCOPe Domain Sequences for d4ozhg2:
Sequence, based on SEQRES records: (download)
>d4ozhg2 b.1.1.2 (G:130-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp
>d4ozhg2 b.1.1.2 (G:130-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsava
wsnksdfacanafnnsiipedtffp
Timeline for d4ozhg2: