SCOPe 2.05: Domain d4ozhg1: 4ozh G:2-129

Lineage for d4ozhg1 (4ozh G:2-129)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (18 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)

Domain d4ozhg1: 4ozh G:2-129 [263386]
Other proteins in same PDB: d4ozha1, d4ozha2, d4ozhb1, d4ozhb2, d4ozhc1, d4ozhc2, d4ozhd1, d4ozhd2, d4ozhe2, d4ozhf1, d4ozhf2, d4ozhg2, d4ozhh1, d4ozhh2
automated match to d2esvd1
complexed with ca, nag

Details for d4ozhg1

PDB Entry: 4ozh (more details), 2.8 Å

PDB Description: s16 protein complex

PDB Compounds: (G:) T-cell receptor, s16, alpha chain

SCOPe Domain Sequences for d4ozhg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ozhg1 b.1.1.1 (G:2-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemas
liitedrksstlilphatlrdtavyycivwggatnklifgtgtllavqpn

SCOPe Domain Coordinates for d4ozhg1:

Click to download the PDB-style file with coordinates for d4ozhg1.
(The format of our PDB-style files is described here.)

Timeline for d4ozhg1: