SCOPe 2.08: Domain d4ozhd1: 4ozh D:3-92

Lineage for d4ozhd1 (4ozh D:3-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d4ozhd1: 4ozh D:3-92 [263384]
   Other proteins in same PDB: d4ozha2, d4ozhb2, d4ozhc2, d4ozhd2, d4ozhe1, d4ozhe2, d4ozhf1, d4ozhf2, d4ozhg1, d4ozhg2, d4ozhh1, d4ozhh2
   automated match to d1klub2
   complexed with ca, nag

Details for d4ozhd1

PDB Entry: 4ozh, 2.8 Å

PDB Description: s16 protein complex

PDB Compounds: (D:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d4ozhd1:

Sequence; same for both SEQRES and ATOM records:

>d4ozhd1 d.19.1.0 (D:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
sqkdilerkraavdrvcrhnyqlelrttlq

Timeline for d4ozhd1:

• d4ozhd1 first appeared in SCOPe 2.05
  
• d4ozhd1 appears in SCOPe 2.07