![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
![]() | Protein automated matches [226842] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
![]() | Domain d4ozhd1: 4ozh D:3-92 [263384] Other proteins in same PDB: d4ozha2, d4ozhb2, d4ozhc2, d4ozhd2, d4ozhe1, d4ozhe2, d4ozhf1, d4ozhf2, d4ozhg1, d4ozhg2, d4ozhh1, d4ozhh2 automated match to d1klub2 complexed with ca, nag |
PDB Entry: 4ozh (more details), 2.8 Å
SCOPe Domain Sequences for d4ozhd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ozhd1 d.19.1.0 (D:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]} spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn sqkdilerkraavdrvcrhnyqlelrttlq
Timeline for d4ozhd1: