Lineage for d4ozhb2 (4ozh B:93-190)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2369068Domain d4ozhb2: 4ozh B:93-190 [263381]
    Other proteins in same PDB: d4ozha1, d4ozha2, d4ozhb1, d4ozhc1, d4ozhc2, d4ozhd1, d4ozhe1, d4ozhe2, d4ozhf2, d4ozhg1, d4ozhg2, d4ozhh2
    automated match to d1sebb1
    complexed with ca, nag

Details for d4ozhb2

PDB Entry: 4ozh (more details), 2.8 Å

PDB Description: s16 protein complex
PDB Compounds: (B:) HLA class II histocompatibility antigen, DQ beta 1 chain

SCOPe Domain Sequences for d4ozhb2:

Sequence, based on SEQRES records: (download)

>d4ozhb2 b.1.1.0 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeetagvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqspitvewra

Sequence, based on observed residues (ATOM records): (download)

>d4ozhb2 b.1.1.0 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispshnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwtfqilv
mlemtpqrgdvytchvehpslqspitvewra

SCOPe Domain Coordinates for d4ozhb2:

Click to download the PDB-style file with coordinates for d4ozhb2.
(The format of our PDB-style files is described here.)

Timeline for d4ozhb2: