Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d4ozhb2: 4ozh B:93-190 [263381] Other proteins in same PDB: d4ozha1, d4ozha2, d4ozhb1, d4ozhc1, d4ozhc2, d4ozhd1, d4ozhe1, d4ozhe2, d4ozhf2, d4ozhg1, d4ozhg2, d4ozhh2 automated match to d1sebb1 complexed with ca, nag |
PDB Entry: 4ozh (more details), 2.8 Å
SCOPe Domain Sequences for d4ozhb2:
Sequence, based on SEQRES records: (download)
>d4ozhb2 b.1.1.0 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeetagvvstplirngd wtfqilvmlemtpqrgdvytchvehpslqspitvewra
>d4ozhb2 b.1.1.0 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrveptvtispshnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwtfqilv mlemtpqrgdvytchvehpslqspitvewra
Timeline for d4ozhb2: