Lineage for d4ozha2 (4ozh A:82-181)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751487Domain d4ozha2: 4ozh A:82-181 [263379]
    Other proteins in same PDB: d4ozha1, d4ozhb1, d4ozhb2, d4ozhc1, d4ozhd1, d4ozhd2, d4ozhe1, d4ozhf1, d4ozhg1, d4ozhh1
    automated match to d4ozfa2
    complexed with ca, nag

Details for d4ozha2

PDB Entry: 4ozh (more details), 2.8 Å

PDB Description: s16 protein complex
PDB Compounds: (A:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d4ozha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ozha2 b.1.1.2 (A:82-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpniliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltllpsaeesydckvehwgldkpllkhwepe

SCOPe Domain Coordinates for d4ozha2:

Click to download the PDB-style file with coordinates for d4ozha2.
(The format of our PDB-style files is described here.)

Timeline for d4ozha2: