Lineage for d4oy7h_ (4oy7 H:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771284Species Streptomyces coelicolor [TaxId:100226] [257350] (3 PDB entries)
  8. 1771294Domain d4oy7h_: 4oy7 H: [263377]
    automated match to d4oy7a_
    complexed with ca, cu

Details for d4oy7h_

PDB Entry: 4oy7 (more details), 1.5 Å

PDB Description: Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper.
PDB Compounds: (H:) Putative secreted cellulose binding protein

SCOPe Domain Sequences for d4oy7h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oy7h_ b.1.18.0 (H:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
hgvammpgsrtylcqldaktgtgaldptnpacqaaldqsgatalynwfavldsnaggrga
gyvpdgtlcsagdrspydfsaynaarsdwprthltsgatipveysnwaahpgdfrvyltk
pgwsptselgwddleliqtvtnppqqgspgtdgghyywdlalpsgrsgdalifmqwvrsd
sqenffscsdvvfdg

SCOPe Domain Coordinates for d4oy7h_:

Click to download the PDB-style file with coordinates for d4oy7h_.
(The format of our PDB-style files is described here.)

Timeline for d4oy7h_: