SCOPe 2.06: Domain d4ox8c_: 4ox8 C:

Lineage for d4ox8c_ (4ox8 C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.56: CcmK-like [143414] (2 families)
   contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape

5. Family d.58.56.0: automated matches [195116] (1 protein)
   not a true family

6. Protein automated matches [195117] (12 species)
   not a true protein

7. Species Prochlorococcus marinus [TaxId:74547] [259233] (1 PDB entry)

8. Domain d4ox8c_: 4ox8 C: [263368]
   automated match to d4ox8a_

Details for d4ox8c_

PDB Entry: 4ox8, 1.9 Å

PDB Description: structure of prochlorococcus marinus str. mit 9313 csos1

PDB Compounds: (C:) Carbon dioxide-concentrating mechanism protein CcmK

SCOPe Domain Sequences for d4ox8c_:

Sequence; same for both SEQRES and ATOM records:

>d4ox8c_ d.58.56.0 (C:) automated matches {Prochlorococcus marinus [TaxId: 74547]}
gialgmietrglvpaieaadamtkaaevrligrefvgggyvtvlvrgetgavnaavraga
dacervgdglvaahiiarphrevepal

Timeline for d4ox8c_:

• d4ox8c_ first appeared in SCOPe 2.05
  
• d4ox8c_ appears in SCOPe 2.07
  
• d4ox8c_ appears in the current release, SCOPe 2.08