Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
Family d.58.56.0: automated matches [195116] (1 protein) not a true family |
Protein automated matches [195117] (12 species) not a true protein |
Species Prochlorococcus marinus [TaxId:74547] [259233] (1 PDB entry) |
Domain d4ox8c_: 4ox8 C: [263368] automated match to d4ox8a_ |
PDB Entry: 4ox8 (more details), 1.9 Å
SCOPe Domain Sequences for d4ox8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ox8c_ d.58.56.0 (C:) automated matches {Prochlorococcus marinus [TaxId: 74547]} gialgmietrglvpaieaadamtkaaevrligrefvgggyvtvlvrgetgavnaavraga dacervgdglvaahiiarphrevepal
Timeline for d4ox8c_: