Lineage for d4ox8c_ (4ox8 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955934Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2956023Family d.58.56.0: automated matches [195116] (1 protein)
    not a true family
  6. 2956024Protein automated matches [195117] (13 species)
    not a true protein
  7. 2956107Species Prochlorococcus marinus [TaxId:74547] [259233] (1 PDB entry)
  8. 2956110Domain d4ox8c_: 4ox8 C: [263368]
    automated match to d4ox8a_

Details for d4ox8c_

PDB Entry: 4ox8 (more details), 1.9 Å

PDB Description: structure of prochlorococcus marinus str. mit 9313 csos1
PDB Compounds: (C:) Carbon dioxide-concentrating mechanism protein CcmK

SCOPe Domain Sequences for d4ox8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ox8c_ d.58.56.0 (C:) automated matches {Prochlorococcus marinus [TaxId: 74547]}
gialgmietrglvpaieaadamtkaaevrligrefvgggyvtvlvrgetgavnaavraga
dacervgdglvaahiiarphrevepal

SCOPe Domain Coordinates for d4ox8c_:

Click to download the PDB-style file with coordinates for d4ox8c_.
(The format of our PDB-style files is described here.)

Timeline for d4ox8c_: