SCOPe 2.08: Domain d4ox6a1: 4ox6 A:1-102

Lineage for d4ox6a1 (4ox6 A:1-102)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.56: CcmK-like [143414] (2 families)
   contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape

5. Family d.58.56.1: CcmK-like [143415] (4 proteins)
   Pfam PF00936; BMC domain

6. Protein automated matches [191074] (7 species)
   not a true protein

7. Species Synechococcus elongatus [TaxId:1140] [259235] (2 PDB entries)

8. Domain d4ox6a1: 4ox6 A:1-102 [263361]
   Other proteins in same PDB: d4ox6a2
   automated match to d2a10c_

Details for d4ox6a1

PDB Entry: 4ox6, 1.34 Å

PDB Description: structure of synechococcus elongatus pcc 7942 ccmk4

PDB Compounds: (A:) Carbon dioxide concentrating mechanism protein CcmK

SCOPe Domain Sequences for d4ox6a1:

Sequence; same for both SEQRES and ATOM records:

>d4ox6a1 d.58.56.1 (A:1-102) automated matches {Synechococcus elongatus [TaxId: 1140]}
msqqaigsletkgfppilaaadamvkagritivsymragsarfavnirgdvsevktamda
gieaakntpggtletwviiprphenveavfpigfgpeveqyr

Timeline for d4ox6a1:

• d4ox6a1 first appeared in SCOPe 2.05, called d4ox6a_
  
• d4ox6a1 appears in SCOPe 2.07