Lineage for d4ov6b_ (4ov6 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2115291Family c.41.1.0: automated matches [191390] (1 protein)
    not a true family
  6. 2115292Protein automated matches [190500] (8 species)
    not a true protein
  7. 2115293Species Human (Homo sapiens) [TaxId:9606] [255634] (7 PDB entries)
  8. 2115300Domain d4ov6b_: 4ov6 B: [263353]
    Other proteins in same PDB: d4ov6f_, d4ov6g_
    automated match to d2w2na_
    complexed with edo, pg4

Details for d4ov6b_

PDB Entry: 4ov6 (more details), 2.69 Å

PDB Description: crystal structure of pcsk9(53-451) with adnectin
PDB Compounds: (B:) Proprotein convertase subtilisin/kexin type 9

SCOPe Domain Sequences for d4ov6b_:

Sequence, based on SEQRES records: (download)

>d4ov6b_ c.41.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sipwnleritppryradeyqppdggslvevylldtsiqsdhreiegrvmvtdfenvpeed
gtrfhrqaskcdshgthlagvvsgrdagvakgasmrslrvlncqgkgtvsgtliglefir
ksqlvqpvgplvvllplaggysrvlnaacqrlaragvvlvtaagnfrddaclyspasape
vitvgatnaqdqpvtlgtlgtnfgrcvdlfapgediigassdcstcfvsqsgtsqaaahv
agiaammlsaepeltlaelrqrlihfsakdvineawfpedqrvltpnlvaalpp

Sequence, based on observed residues (ATOM records): (download)

>d4ov6b_ c.41.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sipwnleritppslvevylldtsiqsdhreiegrvmvtdfenvpeedgtrfhrqaskcds
hgthlagvvsgrdagvakgasmrslrvlncqgkgtvsgtliglefirksqlvqpvgplvv
llplaggysrvlnaacqrlaragvvlvtaagnfrddaclyspasapevitvgatnaqdqp
vtlgtlgtnfgrcvdlfapgediigassdcstcfvsqsgtsqaaahvagiaammlsaepe
ltlaelrqrlihfsakdvineawfpedqrvltpnlvaalpp

SCOPe Domain Coordinates for d4ov6b_:

Click to download the PDB-style file with coordinates for d4ov6b_.
(The format of our PDB-style files is described here.)

Timeline for d4ov6b_: