SCOPe 2.05: Domain d4oule_: 4oul E:

Lineage for d4oule_ (4oul E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.0: automated matches [191519] (1 protein)
   not a true family

6. Protein automated matches [190873] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188225] (20 PDB entries)

8. Domain d4oule_: 4oul E: [263351]
   automated match to d4oulb_
   complexed with ca, gol

Details for d4oule_

PDB Entry: 4oul, 1.95 Å

PDB Description: crystal structure of human caprin-2 c1q domain

PDB Compounds: (E:) Caprin-2

SCOPe Domain Sequences for d4oule_:

Sequence, based on SEQRES records:

>d4oule_ b.22.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlkla
vnvplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswk
ystfsgyllyqd

Sequence, based on observed residues (ATOM records):

>d4oule_ b.22.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrvafsaartsnpgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlklavn
vplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswkys
tfsgyllyqd

Timeline for d4oule_:

• d4oule_ is new in SCOPe 2.05-stable
  
• d4oule_ appears in SCOPe 2.06
  
• d4oule_ appears in the current release, SCOPe 2.08