Lineage for d4ould_ (4oul D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777598Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2777599Protein automated matches [190873] (4 species)
    not a true protein
  7. 2777600Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)
  8. 2777617Domain d4ould_: 4oul D: [263350]
    Other proteins in same PDB: d4oula2
    automated match to d4oulb_
    complexed with ca, gol

Details for d4ould_

PDB Entry: 4oul (more details), 1.95 Å

PDB Description: crystal structure of human caprin-2 c1q domain
PDB Compounds: (D:) Caprin-2

SCOPe Domain Sequences for d4ould_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ould_ b.22.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlkla
vnvplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswk
ystfsgyllyqd

SCOPe Domain Coordinates for d4ould_:

Click to download the PDB-style file with coordinates for d4ould_.
(The format of our PDB-style files is described here.)

Timeline for d4ould_: