SCOPe 2.08: Domain d4oula1: 4oul A:997-1127

Lineage for d4oula1 (4oul A:997-1127)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.0: automated matches [191519] (1 protein)
   not a true family

6. Protein automated matches [190873] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)

8. Domain d4oula1: 4oul A:997-1127 [263348]
   Other proteins in same PDB: d4oula2
   automated match to d4oulb_
   complexed with ca, gol

Details for d4oula1

PDB Entry: 4oul, 1.95 Å

PDB Description: crystal structure of human caprin-2 c1q domain

PDB Compounds: (A:) Caprin-2

SCOPe Domain Sequences for d4oula1:

Sequence; same for both SEQRES and ATOM records:

>d4oula1 b.22.1.0 (A:997-1127) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvafsaartsnlapgtldqpivfdlllnnlgetfdlqlgrfncpvngtyvfifhmlklav
nvplyvnlmkneevlvsayandgapdhetasnhailqlfqgdqiwlrlhrgaiygsswky
stfsgyllyqd

Timeline for d4oula1:

• d4oula1 first appeared in SCOPe 2.05, called d4oula_
  
• d4oula1 appears in SCOPe 2.07