Lineage for d4oufa_ (4ouf A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731437Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1731438Family a.29.2.1: Bromodomain [47371] (5 proteins)
  6. 1731439Protein CREB-binding protein, CBP [74712] (1 species)
  7. 1731440Species Human (Homo sapiens) [TaxId:9606] [74713] (7 PDB entries)
  8. 1731441Domain d4oufa_: 4ouf A: [263345]
    automated match to d2l84a_
    complexed with edo, peg

Details for d4oufa_

PDB Entry: 4ouf (more details), 1.4 Å

PDB Description: Crystal Structure of CBP bromodomain
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d4oufa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oufa_ a.29.2.1 (A:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl

SCOPe Domain Coordinates for d4oufa_:

Click to download the PDB-style file with coordinates for d4oufa_.
(The format of our PDB-style files is described here.)

Timeline for d4oufa_: