Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins) formerly omega-Aminoacid:pyruvate aminotransferase-like |
Protein automated matches [190152] (25 species) not a true protein |
Species Burkholderia cenocepacia [TaxId:216591] [229698] (4 PDB entries) |
Domain d4ot8d_: 4ot8 D: [263344] Other proteins in same PDB: d4ot8c2 automated match to d4n0wa_ complexed with plp, ser |
PDB Entry: 4ot8 (more details), 2 Å
SCOPe Domain Sequences for d4ot8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ot8d_ c.67.1.4 (D:) automated matches {Burkholderia cenocepacia [TaxId: 216591]} stianvdpeifaaieqenrrqedhieliasenytspavmaaqgsqltnkyaegypgkryy ggceyvdvveqlaidrvkqlfgaeaanvqpnsgsqanqgvffamlkpgdtimgmslahgg hlthgspvnmsgkwfnvvsyglnenedidydaaeklanehkpklivagasafalkidfer lakiaksvgaylmvdmahyagliaagvypnpvphadfvtttthkslrgprggvilmkaey ekpinsaifpgiqggplmhviaakavafkealspefkeyqqkvvenarvlaetlvkrglr ivsgrteshvmlvdlrakhitgkaaeaalgaahitvnknaipndpekpfvtsgirlgspa mttrgfgpaeaeqvgnliadvlenpedaatiervraqvaeltkrfpvy
Timeline for d4ot8d_:
View in 3D Domains from other chains: (mouse over for more information) d4ot8a_, d4ot8b_, d4ot8c1, d4ot8c2 |