SCOPe 2.05: Domain d4ot8b_: 4ot8 B:

Lineage for d4ot8b_ (4ot8 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein automated matches [190152] (18 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [229698] (4 PDB entries)

8. Domain d4ot8b_: 4ot8 B: [263342]
   automated match to d4n0wa_
   complexed with plp, ser

Details for d4ot8b_

PDB Entry: 4ot8, 2 Å

PDB Description: X-ray Crystal Structure of Serine Hydroxymethyl Transferase from Burkholderia cenocepacia bound to PLP and Serine

PDB Compounds: (B:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d4ot8b_:

Sequence; same for both SEQRES and ATOM records:

>d4ot8b_ c.67.1.4 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
aqstianvdpeifaaieqenrrqedhieliasenytspavmaaqgsqltnkyaegypgkr
yyggceyvdvveqlaidrvkqlfgaeaanvqpnsgsqanqgvffamlkpgdtimgmslah
gghlthgspvnmsgkwfnvvsyglnenedidydaaeklanehkpklivagasafalkidf
erlakiaksvgaylmvdmahyagliaagvypnpvphadfvtttthkslrgprggvilmka
eyekpinsaifpgiqggplmhviaakavafkealspefkeyqqkvvenarvlaetlvkrg
lrivsgrteshvmlvdlrakhitgkaaeaalgaahitvnknaipndpekpfvtsgirlgs
pamttrgfgpaeaeqvgnliadvlenpedaatiervraqvaeltkrfpvyr

Timeline for d4ot8b_:

• d4ot8b_ is new in SCOPe 2.05-stable
  
• d4ot8b_ appears in SCOPe 2.06
  
• d4ot8b_ appears in the current release, SCOPe 2.08