Lineage for d4oryg_ (4ory G:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2073091Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2073092Protein automated matches [190698] (21 species)
    not a true protein
  7. 2073121Species Human (Homo sapiens) [TaxId:9606] [187833] (30 PDB entries)
  8. 2073161Domain d4oryg_: 4ory G: [263340]
    automated match to d2k23a_
    complexed with peu; mutant

Details for d4oryg_

PDB Entry: 4ory (more details), 1.8 Å

PDB Description: Three-dimensional structure of the C65A-K59A double mutant of Human lipocalin-type Prostaglandin D Synthase holo, second crystal form
PDB Compounds: (G:) Prostaglandin-H2 D-isomerase

SCOPe Domain Sequences for d4oryg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oryg_ b.60.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apeaqvsvqpnfqqdkflgrwfsaglasnsswlrekaaalsmaksvvapatdgglnltst
flrknqcetrtmllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpged
frmatlysrtqtpraelkekftafckaqgftedtivflpqtdkcmt

SCOPe Domain Coordinates for d4oryg_:

Click to download the PDB-style file with coordinates for d4oryg_.
(The format of our PDB-style files is described here.)

Timeline for d4oryg_: