Lineage for d1ao5a_ (1ao5 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 protein domains)
  6. 15127Protein Kallikrein-13 [50572] (1 species)
  7. 15128Species Mouse (Mus musculus) [TaxId:10090] [50573] (1 PDB entry)
  8. 15129Domain d1ao5a_: 1ao5 A: [26334]

Details for d1ao5a_

PDB Entry: 1ao5 (more details), 2.6 Å

PDB Description: mouse glandular kallikrein-13 (prorenin converting enzyme)

SCOP Domain Sequences for d1ao5a_:

Sequence, based on SEQRES records: (download)

>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus)}
vvggfnceknsqpwqvavyyqkehicggvlldrnwvltaahcyvdqyevwlgknklfqee
psaqhrlvsksfphpgfnmsllmlqtippgadfsddlmllrlskpaditdvvkpialptk
epkpgskclasgwgsitptrwqkpddlqcvfitllpnencakvylqkvtdvmlcagemgg
gkdtcrddsggplicdgilqgttsygpvpcgkpgvpaiytnlikfnswikdtmmkna

Sequence, based on observed residues (ATOM records): (download)

>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus)}
vvggfnceknsqpwqvavyyqkehicggvlldrnwvltaahcyvdqyevwlgknklfqee
psaqhrlvsksfphpgfnmsllmlqtippgadfsddlmllrlskpaditdvvkpialptk
epkpgskclasgwgsitptwqkpddlqcvfitllpnencakvylqkvtdvmlcagemggg
kdtcrddsggplicdgilqgttsygpvpcgkpgvpaiytnlikfnswikdtmmkna

SCOP Domain Coordinates for d1ao5a_:

Click to download the PDB-style file with coordinates for d1ao5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ao5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ao5b_