Class a: All alpha proteins [46456] (286 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin T1 [158595] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158596] (10 PDB entries) Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150 |
Domain d4or5g2: 4or5 G:151-261 [263336] Other proteins in same PDB: d4or5a_, d4or5f_ automated match to d2pk2a1 protein/RNA complex; complexed with so4, yt3, zn |
PDB Entry: 4or5 (more details), 2.9 Å
SCOPe Domain Sequences for d4or5g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4or5g2 a.74.1.1 (G:151-261) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]} dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw eipvstdgkhwweyvdatvtlelldeltheflqilektpnrlkriwnwrac
Timeline for d4or5g2:
View in 3D Domains from other chains: (mouse over for more information) d4or5a_, d4or5b1, d4or5b2, d4or5f_ |