![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein automated matches [190406] (22 species) not a true protein |
![]() | Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (23 PDB entries) |
![]() | Domain d4oqwe1: 4oqw E:3-224 [263330] Other proteins in same PDB: d4oqwa2, d4oqwb2, d4oqwd2, d4oqwe2, d4oqwg2, d4oqwh2 automated match to d3ip2a_ |
PDB Entry: 4oqw (more details), 2.21 Å
SCOPe Domain Sequences for d4oqwe1:
Sequence, based on SEQRES records: (download)
>d4oqwe1 d.22.1.1 (E:3-224) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]} elikenmhmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfafdilatcf mygsktfinhtqgipdffkqsfpegftwervttyedggvltvtqdtslqdgcliynvklr gvnfpsngpvmqkktlgweattetlypadgglegrcdmalklvggghlhcnlkttyrskk paknlkmpgvyfvdrrlerikeadnetyveqhevavarycdl
>d4oqwe1 d.22.1.1 (E:3-224) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]} elikenmhmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfafdilatcf mygsktfinhtqgipdffkqsfpegftwervttyedggvltvtqdtslqdgcliynvklr gvnfpsngpvmqkktlgweattetlypaglegrcdmalklvggglhcnlkttyrskkpak lkmpgvyfvdrrlerikeatyveqhevavarycdl
Timeline for d4oqwe1: