Lineage for d4oqwe1 (4oqw E:3-224)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940534Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [188538] (24 PDB entries)
  8. 2940576Domain d4oqwe1: 4oqw E:3-224 [263330]
    Other proteins in same PDB: d4oqwa2, d4oqwb2, d4oqwd2, d4oqwe2, d4oqwg2, d4oqwh2
    automated match to d3ip2a_

Details for d4oqwe1

PDB Entry: 4oqw (more details), 2.21 Å

PDB Description: Crystal structure of mCardinal far-red fluorescent protein
PDB Compounds: (E:) Fluorescent protein FP480

SCOPe Domain Sequences for d4oqwe1:

Sequence, based on SEQRES records: (download)

>d4oqwe1 d.22.1.1 (E:3-224) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
elikenmhmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfafdilatcf
mygsktfinhtqgipdffkqsfpegftwervttyedggvltvtqdtslqdgcliynvklr
gvnfpsngpvmqkktlgweattetlypadgglegrcdmalklvggghlhcnlkttyrskk
paknlkmpgvyfvdrrlerikeadnetyveqhevavarycdl

Sequence, based on observed residues (ATOM records): (download)

>d4oqwe1 d.22.1.1 (E:3-224) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
elikenmhmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfafdilatcf
mygsktfinhtqgipdffkqsfpegftwervttyedggvltvtqdtslqdgcliynvklr
gvnfpsngpvmqkktlgweattetlypaglegrcdmalklvggglhcnlkttyrskkpak
lkmpgvyfvdrrlerikeatyveqhevavarycdl

SCOPe Domain Coordinates for d4oqwe1:

Click to download the PDB-style file with coordinates for d4oqwe1.
(The format of our PDB-style files is described here.)

Timeline for d4oqwe1: