Lineage for d1bqyb_ (1bqy B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15155Protein Plasminogen activator from snake venom, TSV-PA [50570] (1 species)
  7. 15156Species Chinese green tree viper (Trimeresurus stejnejeri) [50571] (1 PDB entry)
  8. 15158Domain d1bqyb_: 1bqy B: [26333]

Details for d1bqyb_

PDB Entry: 1bqy (more details), 2.5 Å

PDB Description: Plasminogen activator (TSV-PA) from snake venom

SCOP Domain Sequences for d1bqyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqyb_ b.47.1.2 (B:) Plasminogen activator from snake venom, TSV-PA {Chinese green tree viper (Trimeresurus stejnejeri)}
vfggdecninehrslvvlfnsngflcggtlinqdwvvtaahcdsnnfqllfgvhskkiln
edeqtrdpkekffcpnrkkddevdkdimlikldssvsnsehiaplslpssppsvgsvcri
mgwgktiptkeiypdvphcaninildhavcrtayswrqvanttlcagilqggrdtchfds
ggplicngifqgivswgghpcgqpgepgvytkvfdyldwiksiiagnkdatcpp

SCOP Domain Coordinates for d1bqyb_:

Click to download the PDB-style file with coordinates for d1bqyb_.
(The format of our PDB-style files is described here.)

Timeline for d1bqyb_: