Lineage for d1bqyb_ (1bqy B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. Protein Venom serine protease [50570] (2 species)
  7. Species Chinese green tree viper (Trimeresurus stejnegeri) [TaxId:39682] [50571] (1 PDB entry)
  8. Domain d1bqyb_: 1bqy B: [26333]
    complexed with 0gj

Details for d1bqyb_

PDB Entry: 1bqy (more details), 2.5 Å

PDB Description: Plasminogen activator (TSV-PA) from snake venom
PDB Compounds: (B:) plasminogen activator

SCOPe Domain Sequences for d1bqyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqyb_ b.47.1.2 (B:) Venom serine protease {Chinese green tree viper (Trimeresurus stejnegeri) [TaxId: 39682]}
vfggdecninehrslvvlfnsngflcggtlinqdwvvtaahcdsnnfqllfgvhskkiln
edeqtrdpkekffcpnrkkddevdkdimlikldssvsnsehiaplslpssppsvgsvcri
mgwgktiptkeiypdvphcaninildhavcrtayswrqvanttlcagilqggrdtchfds
ggplicngifqgivswgghpcgqpgepgvytkvfdyldwiksiiagnkdatcpp

SCOPe Domain Coordinates for d1bqyb_ are not available.

Timeline for d1bqyb_:

Domains from other chains:
(mouse over for more information)
d1bqya_