Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) |
Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
Protein automated matches [191112] (14 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [257310] (2 PDB entries) |
Domain d4oqqb_: 4oqq B: [263326] automated match to d3nzeb_ complexed with bcn |
PDB Entry: 4oqq (more details), 1.8 Å
SCOPe Domain Sequences for d4oqqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oqqb_ c.124.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]} edldalgsileekyglleahvvfsptpdyagithdlsrygaeymhetvkdgdivgvswgt tmyqiaqnmqpkqvkgvevvqlkggishsrvntysaetiqlfaeafqtmprylplpvvfd nadvkrmvekdrhieriiemgkqanialftvgtvrdeallfrlgyfneeekallkkqavg dicsrffdakgnicssaindrtigvelqdlrlkersilvaggsrkvssihgaltgkyanv liidqhtaralvnd
Timeline for d4oqqb_: