Lineage for d4oqqb_ (4oqq B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922594Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2922595Protein automated matches [191112] (17 species)
    not a true protein
  7. 2922668Species Bacillus subtilis [TaxId:224308] [257310] (2 PDB entries)
  8. 2922671Domain d4oqqb_: 4oqq B: [263326]
    automated match to d3nzeb_
    complexed with bcn

Details for d4oqqb_

PDB Entry: 4oqq (more details), 1.8 Å

PDB Description: Structure of the effector-binding domain of deoxyribonucleoside regulator DeoR from Bacillus subtilis
PDB Compounds: (B:) Deoxyribonucleoside regulator

SCOPe Domain Sequences for d4oqqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oqqb_ c.124.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
edldalgsileekyglleahvvfsptpdyagithdlsrygaeymhetvkdgdivgvswgt
tmyqiaqnmqpkqvkgvevvqlkggishsrvntysaetiqlfaeafqtmprylplpvvfd
nadvkrmvekdrhieriiemgkqanialftvgtvrdeallfrlgyfneeekallkkqavg
dicsrffdakgnicssaindrtigvelqdlrlkersilvaggsrkvssihgaltgkyanv
liidqhtaralvnd

SCOPe Domain Coordinates for d4oqqb_:

Click to download the PDB-style file with coordinates for d4oqqb_.
(The format of our PDB-style files is described here.)

Timeline for d4oqqb_: