Lineage for d4ooub1 (4oou B:20-382)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095444Species Cryptopygus antarcticus [TaxId:187623] [258696] (2 PDB entries)
  8. 2095446Domain d4ooub1: 4oou B:20-382 [263321]
    Other proteins in same PDB: d4ooua2, d4ooub2
    automated match to d4oozb_
    complexed with trs

Details for d4ooub1

PDB Entry: 4oou (more details), 2.36 Å

PDB Description: crystal structure of beta-1,4-d-mannanase from cryptopygus antarcticus
PDB Compounds: (B:) beta-1,4-mannanase

SCOPe Domain Sequences for d4ooub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ooub1 c.1.8.0 (B:20-382) automated matches {Cryptopygus antarcticus [TaxId: 187623]}
seflkasgsnfyyggqkvflsgvnfawrsygsdfgngqyasngpalkdwinkvkasggnt
arvwvhvegqvspafdshgfvtstdskktlindlsdlldyangqnvflilvlfngalqnn
snvqnlfwdesklnsyinnaltpmvnalkskpslaawevlnepegtlqpgsdqnscydts
tlaaqgagwggkkfpmkqilktinwissaihnadskalvtvgswseltqtdsfgyrnhyk
dscltgaggksngiinfyqmhtyshsgkwnqnapfkvnrwaynvndkplligefasvcsq
negiqnlykyaynngyngaltwqfnsggdcsdtysnqmygmqalkgqndqsggkggmvsv
nin

SCOPe Domain Coordinates for d4ooub1:

Click to download the PDB-style file with coordinates for d4ooub1.
(The format of our PDB-style files is described here.)

Timeline for d4ooub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ooub2