Lineage for d1bqya_ (1bqy A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2796816Protein Venom serine protease [50570] (2 species)
  7. 2796817Species Chinese green tree viper (Trimeresurus stejnegeri) [TaxId:39682] [50571] (1 PDB entry)
  8. 2796818Domain d1bqya_: 1bqy A: [26332]
    complexed with 0gj

Details for d1bqya_

PDB Entry: 1bqy (more details), 2.5 Å

PDB Description: Plasminogen activator (TSV-PA) from snake venom
PDB Compounds: (A:) plasminogen activator

SCOPe Domain Sequences for d1bqya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqya_ b.47.1.2 (A:) Venom serine protease {Chinese green tree viper (Trimeresurus stejnegeri) [TaxId: 39682]}
vfggdecninehrslvvlfnsngflcggtlinqdwvvtaahcdsnnfqllfgvhskkiln
edeqtrdpkekffcpnrkkddevdkdimlikldssvsnsehiaplslpssppsvgsvcri
mgwgktiptkeiypdvphcaninildhavcrtayswrqvanttlcagilqggrdtchfds
ggplicngifqgivswgghpcgqpgepgvytkvfdyldwiksiiagnkdatcpp

SCOPe Domain Coordinates for d1bqya_:

Click to download the PDB-style file with coordinates for d1bqya_.
(The format of our PDB-style files is described here.)

Timeline for d1bqya_: