Lineage for d4okvd1 (4okv D:1-112)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766783Domain d4okvd1: 4okv D:1-112 [263313]
    Other proteins in same PDB: d4okvb2, d4okvd2
    automated match to d1f3dj1

Details for d4okvd1

PDB Entry: 4okv (more details), 1.8 Å

PDB Description: Crystal structure of anopheline anti-platelet protein with Fab antibody
PDB Compounds: (D:) light chain of 8H7 mAb

SCOPe Domain Sequences for d4okvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4okvd1 b.1.1.0 (D:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtpltlsvtigqpasiackssqslldsdgktylnwllqrpgqspkrliylvskld
sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleik

SCOPe Domain Coordinates for d4okvd1:

Click to download the PDB-style file with coordinates for d4okvd1.
(The format of our PDB-style files is described here.)

Timeline for d4okvd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4okvd2