SCOPe 2.05: Domain d4okvd1: 4okv D:1-112

Lineage for d4okvd1 (4okv D:1-112)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d4okvd1: 4okv D:1-112 [263313]
   Other proteins in same PDB: d4okvb2, d4okvd2
   automated match to d1f3dj1

Details for d4okvd1

PDB Entry: 4okv, 1.8 Å

PDB Description: Crystal structure of anopheline anti-platelet protein with Fab antibody

PDB Compounds: (D:) light chain of 8H7 mAb

SCOPe Domain Sequences for d4okvd1:

Sequence; same for both SEQRES and ATOM records:

>d4okvd1 b.1.1.0 (D:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtpltlsvtigqpasiackssqslldsdgktylnwllqrpgqspkrliylvskld
sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleik

Timeline for d4okvd1:

• d4okvd1 is new in SCOPe 2.05-stable
  
• d4okvd1 appears in SCOPe 2.06
  
• d4okvd1 appears in the current release, SCOPe 2.08