![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
![]() | Protein automated matches [190513] (36 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries) |
![]() | Domain d4okhb1: 4okh B:647-821 [263298] Other proteins in same PDB: d4okha2, d4okhb2 automated match to d4okha_ complexed with ca, peu |
PDB Entry: 4okh (more details), 2.45 Å
SCOPe Domain Sequences for d4okhb1:
Sequence, based on SEQRES records: (download)
>d4okhb1 a.39.1.0 (B:647-821) automated matches {Human (Homo sapiens) [TaxId: 9606]} eseeqqqfrnifkqiagddmeicadelkkvlntvvnkhkdlkthgftlescrsmialmdt dgsgklnlqefhhlwnkikawqkifkhydtdqsgtinsyemrnavndagfhlnnqlydii tmryadkhmnidfdsficcfvrlegmfrafhafdkdgdgiiklnvlewlqltmya
>d4okhb1 a.39.1.0 (B:647-821) automated matches {Human (Homo sapiens) [TaxId: 9606]} eseeqqqfrnifkqiagddmeicadelkkvlntvvnthgftlescrsmialmdtdgsgkl nlqefhhlwnkikawqkifkhydtdqsgtinsyemrnavndagfhlnnqlydiitmryad khmnidfdsficcfvrlegmfrafhafdkdgdgiiklnvlewlqltmya
Timeline for d4okhb1: