SCOPe 2.07: Domain d4okhb1: 4okh B:647-821

Lineage for d4okhb1 (4okh B:647-821)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (52 PDB entries)

8. Domain d4okhb1: 4okh B:647-821 [263298]
   Other proteins in same PDB: d4okha2, d4okhb2
   automated match to d4okha_
   complexed with ca, peu

Details for d4okhb1

PDB Entry: 4okh, 2.45 Å

PDB Description: Crystal structure of calpain-3 penta-EF-hand domain

PDB Compounds: (B:) Calpain-3

SCOPe Domain Sequences for d4okhb1:

Sequence, based on SEQRES records:

>d4okhb1 a.39.1.0 (B:647-821) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eseeqqqfrnifkqiagddmeicadelkkvlntvvnkhkdlkthgftlescrsmialmdt
dgsgklnlqefhhlwnkikawqkifkhydtdqsgtinsyemrnavndagfhlnnqlydii
tmryadkhmnidfdsficcfvrlegmfrafhafdkdgdgiiklnvlewlqltmya

Sequence, based on observed residues (ATOM records):

>d4okhb1 a.39.1.0 (B:647-821) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eseeqqqfrnifkqiagddmeicadelkkvlntvvnthgftlescrsmialmdtdgsgkl
nlqefhhlwnkikawqkifkhydtdqsgtinsyemrnavndagfhlnnqlydiitmryad
khmnidfdsficcfvrlegmfrafhafdkdgdgiiklnvlewlqltmya

Timeline for d4okhb1:

• d4okhb1 first appeared in SCOPe 2.05, called d4okhb_
  
• d4okhb1 appears in SCOPe 2.06