SCOPe 2.05: Domain d4oj0c_: 4oj0 C:

Lineage for d4oj0c_ (4oj0 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (20 species)
   not a true protein

7. Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [267983] (1 PDB entry)

8. Domain d4oj0c_: 4oj0 C: [263296]
   Other proteins in same PDB: d4oj0a_
   automated match to d3st2a_

Details for d4oj0c_

PDB Entry: 4oj0, 1.7 Å

PDB Description: mCardinal V218E

PDB Compounds: (C:) Fluorescent protein FP480

SCOPe Domain Sequences for d4oj0c_:

Sequence; same for both SEQRES and ATOM records:

>d4oj0c_ d.22.1.0 (C:) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
eelikenmpmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfafdilatc
fmygsktfikhpkgipdffkqsfpegftwervttyedggvltvtqdtslqdgcliynvkl
rgvnfpsngpvmqkktlgweattetlypadgglegrcdmalkldggghlhcnlkttyrsk
kpagnlkmpgvyfvdrrlerikeadnetyveqhevaearycdlpskl

Timeline for d4oj0c_:

• d4oj0c_ is new in SCOPe 2.05-stable
  
• d4oj0c_ is called d4oj0c1 in SCOPe 2.06
  
• d4oj0c_ appears in the current release, SCOPe 2.08, called d4oj0c1