Lineage for d4oj0c1 (4oj0 C:3-228)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2941124Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [267983] (3 PDB entries)
  8. 2941126Domain d4oj0c1: 4oj0 C:3-228 [263296]
    Other proteins in same PDB: d4oj0a1, d4oj0a2, d4oj0b2, d4oj0c2, d4oj0d2
    automated match to d3st2a_

Details for d4oj0c1

PDB Entry: 4oj0 (more details), 1.7 Å

PDB Description: mCardinal V218E
PDB Compounds: (C:) Fluorescent protein FP480

SCOPe Domain Sequences for d4oj0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oj0c1 d.22.1.0 (C:3-228) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
elikenmpmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfafdilatcf
mygsktfikhpkgipdffkqsfpegftwervttyedggvltvtqdtslqdgcliynvklr
gvnfpsngpvmqkktlgweattetlypadgglegrcdmalkldggghlhcnlkttyrskk
pagnlkmpgvyfvdrrlerikeadnetyveqhevaearycdlpskl

SCOPe Domain Coordinates for d4oj0c1:

Click to download the PDB-style file with coordinates for d4oj0c1.
(The format of our PDB-style files is described here.)

Timeline for d4oj0c1: