SCOPe 2.08: Domain d4oj0b1: 4oj0 B:3-228

Lineage for d4oj0b1 (4oj0 B:3-228)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (26 species)
   not a true protein

7. Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [267983] (3 PDB entries)

8. Domain d4oj0b1: 4oj0 B:3-228 [263295]
   Other proteins in same PDB: d4oj0a1, d4oj0a2, d4oj0b2, d4oj0c2, d4oj0d2
   automated match to d3st2a_

Details for d4oj0b1

PDB Entry: 4oj0, 1.7 Å

PDB Description: mCardinal V218E

PDB Compounds: (B:) Fluorescent protein FP480

SCOPe Domain Sequences for d4oj0b1:

Sequence; same for both SEQRES and ATOM records:

>d4oj0b1 d.22.1.0 (B:3-228) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]}
elikenmpmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfafdilatcf
mygsktfikhpkgipdffkqsfpegftwervttyedggvltvtqdtslqdgcliynvklr
gvnfpsngpvmqkktlgweattetlypadgglegrcdmalkldggghlhcnlkttyrskk
pagnlkmpgvyfvdrrlerikeadnetyveqhevaearycdlpskl

Timeline for d4oj0b1:

• d4oj0b1 first appeared in SCOPe 2.05, called d4oj0b_
  
• d4oj0b1 appears in SCOPe 2.07