Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (26 species) not a true protein |
Species Sea anemone (Entacmaea quadricolor) [TaxId:6118] [267983] (3 PDB entries) |
Domain d4oj0b1: 4oj0 B:3-228 [263295] Other proteins in same PDB: d4oj0a1, d4oj0a2, d4oj0b2, d4oj0c2, d4oj0d2 automated match to d3st2a_ |
PDB Entry: 4oj0 (more details), 1.7 Å
SCOPe Domain Sequences for d4oj0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oj0b1 d.22.1.0 (B:3-228) automated matches {Sea anemone (Entacmaea quadricolor) [TaxId: 6118]} elikenmpmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfafdilatcf mygsktfikhpkgipdffkqsfpegftwervttyedggvltvtqdtslqdgcliynvklr gvnfpsngpvmqkktlgweattetlypadgglegrcdmalkldggghlhcnlkttyrskk pagnlkmpgvyfvdrrlerikeadnetyveqhevaearycdlpskl
Timeline for d4oj0b1: