SCOPe 2.08: Domain d4oiya1: 4oiy A:824-1010

Lineage for d4oiya1 (4oiy A:824-1010)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.3: Sec7 domain [48425] (2 families)

5. Family a.118.3.0: automated matches [191673] (1 protein)
   not a true family

6. Protein automated matches [191283] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [258040] (1 PDB entry)

8. Domain d4oiya1: 4oiy A:824-1010 [263294]
   Other proteins in same PDB: d4oiya2
   automated match to d1ku1a_
   complexed with mg

Details for d4oiya1

PDB Entry: 4oiy, 1.5 Å

PDB Description: Crystal structure of Sec7p catalytic domain

PDB Compounds: (A:) Protein transport protein SEC7

SCOPe Domain Sequences for d4oiya1:

Sequence; same for both SEQRES and ATOM records:

>d4oiya1 a.118.3.0 (A:824-1010) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
lklrktalseciaifnnkpkkaipvlikkgflkddspisiakwlletegldmaavgdylg
egddkniaimhafvdefdftgmsivdalrsflqsfrlpgegqkidrfmlkfaerfvdqnp
gvfskadtayvlsyslimlntdlhssqiknkmslqeflennegidngrdlprdfleglfn
eiannei

Timeline for d4oiya1:

• d4oiya1 first appeared in SCOPe 2.05, called d4oiya_
  
• d4oiya1 appears in SCOPe 2.07