SCOPe 2.08: Domain d4ohlb1: 4ohl B:3-110

Lineage for d4ohlb1 (4ohl B:3-110)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)

8. Domain d4ohlb1: 4ohl B:3-110 [263288]
   Other proteins in same PDB: d4ohla3, d4ohlb3
   automated match to d2b3oa1
   mutant

Details for d4ohlb1

PDB Entry: 4ohl, 2.4 Å

PDB Description: LEOPARD Syndrome-Associated SHP2/T468M mutant

PDB Compounds: (B:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d4ohlb1:

Sequence; same for both SEQRES and ATOM records:

>d4ohlb1 d.93.1.0 (B:3-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptse

Timeline for d4ohlb1:

• d4ohlb1 first appeared in SCOPe 2.05
  
• d4ohlb1 appears in SCOPe 2.07