SCOPe 2.05: Domain d4ogyb_: 4ogy B:

Lineage for d4ogyb_ (4ogy B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (136 PDB entries)

8. Domain d4ogyb_: 4ogy B: [263287]
   Other proteins in same PDB: d4ogyl1, d4ogyl2, d4ogyn1, d4ogyn2
   automated match to d4ogya_
   complexed with edo

Details for d4ogyb_

PDB Entry: 4ogy, 2.1 Å

PDB Description: Crystal structure of Fab DX-2930 in complex with human plasma kallikrein at 2.1 Angstrom resolution

PDB Compounds: (B:) Plasma kallikrein

SCOPe Domain Sequences for d4ogyb_:

Sequence; same for both SEQRES and ATOM records:

>d4ogyb_ b.47.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggtesswgewpwqvslqvkltaqrhlcggslighqwvltaahcfdglplqdvwriysg
ilelsditkdtpfsqikeiiihqnykvsegnhdialiklqapleytefqkpislpskgdt
stiytncwvtgwgfskekgeiqnilqkvniplvtneecqkryqdykitqrmvcagykegg
kdackgdsggplvckhngmwrlvgitswgegcarreqpgvytkvaeymdwilektqssd

Timeline for d4ogyb_:

• d4ogyb_ is new in SCOPe 2.05-stable
  
• d4ogyb_ appears in SCOPe 2.06
  
• d4ogyb_ appears in the current release, SCOPe 2.08