SCOPe 2.05: Domain d4ogsb_: 4ogs B:

Lineage for d4ogsb_ (4ogs B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (4 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (167 PDB entries)
   Uniprot P42212

8. Domain d4ogsb_: 4ogs B: [263286]
   automated match to d3st2a_
   complexed with cl

Details for d4ogsb_

PDB Entry: 4ogs, 2.21 Å

PDB Description: Crystal structure of GFP S205A/T203V at 2.2 A resolution

PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d4ogsb_:

Sequence; same for both SEQRES and ATOM records:

>d4ogsb_ d.22.1.1 (B:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
fgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyq
qntpigdgpvllpdnhylsvqaalskdpnekrdhmvllefvtaagith

Timeline for d4ogsb_:

• d4ogsb_ is new in SCOPe 2.05-stable
  
• d4ogsb_ appears in SCOPe 2.06
  
• d4ogsb_ appears in the current release, SCOPe 2.08