| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Necator americanus [TaxId:51031] [224849] (6 PDB entries) |
| Domain d4oftb2: 4oft B:78-206 [263283] Other proteins in same PDB: d4ofta1, d4oftb1 automated match to d2on7a2 |
PDB Entry: 4oft (more details), 2.6 Å
SCOPe Domain Sequences for d4oftb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oftb2 a.45.1.0 (B:78-206) automated matches {Necator americanus [TaxId: 51031]}
agkstfdeavvdsladqysdyrveiksffytvigmregdveqlkkevllpardkffgfit
kflkkspsgflvgdsltwvdllvsehnatmltfvpeflegypevkehmekiraipklkkw
ietrpetlf
Timeline for d4oftb2: