SCOPe 2.06: Domain d1a5h.2: 1a5h D:,B:

Lineage for d1a5h.2 (1a5h D:,B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Two-chain tissue plasminogen activator (TC)-T-PA [50565] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50566] (2 PDB entries)

8. Domain d1a5h.2: 1a5h D:,B: [26328]
   complexed with bba

Details for d1a5h.2

PDB Entry: 1a5h, 2.9 Å

PDB Description: catalytic domain of human two-chain tissue plasminogen activator complex of a bis-benzamidine

PDB Compounds: (B:) tissue plasminogen activator, (D:) tissue plasminogen activator

SCOPe Domain Sequences for d1a5h.2:

Sequence; same for both SEQRES and ATOM records:

>g1a5h.2 b.47.1.2 (D:,B:) Two-chain tissue plasminogen activator (TC)-T-PA {Human (Homo sapiens) [TaxId: 9606]}
tcglrqyXikgglfadiashpwqaaifakhrrspgerflcggilisscwilsaahcfqer
fpphhltvilgrtyrvvpgeeeqkfevekyivhkefdddtydndiallqlksdssrcaqe
ssvvrtvclppadlqlpdwtecelsgygkhealspfyserlkeahvrlypssrctsqhll
nrtvtdnmlcagdtrsggpqanlhdacqgdsggplvclndgrmtlvgiiswglgcgqkdv
pgvytkvtnyldwirdnmrp

Timeline for d1a5h.2:

• d1a5h.2 first appeared (with stable ids) in SCOP 1.55
  
• d1a5h.2 appears in SCOPe 2.05
  
• d1a5h.2 appears in SCOPe 2.07
  
• d1a5h.2 appears in the current release, SCOPe 2.08