Lineage for d4ocna_ (4ocn A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2525733Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2526149Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) (S)
  5. 2526150Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins)
    Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)
  6. 2526182Protein Proteasome regulatory subunit Rpn8 [346089] (1 species)
  7. 2526183Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346339] (9 PDB entries)
  8. 2526191Domain d4ocna_: 4ocn A: [263275]
    Other proteins in same PDB: d4ocnb_, d4ocnc_, d4ocne_, d4ocnf_
    automated match to d2o95a_

Details for d4ocna_

PDB Entry: 4ocn (more details), 2.25 Å

PDB Description: crystal structure of the rpn8-rpn11 mpn domain heterodimer, crystal form ii
PDB Compounds: (A:) 26s proteasome regulatory subunit rpn8

SCOPe Domain Sequences for d4ocna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ocna_ c.97.3.1 (A:) Proteasome regulatory subunit Rpn8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedekn
sdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnpllli
vdvkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllr

SCOPe Domain Coordinates for d4ocna_:

Click to download the PDB-style file with coordinates for d4ocna_.
(The format of our PDB-style files is described here.)

Timeline for d4ocna_: