| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) ![]() |
| Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins) Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1) |
| Protein Proteasome regulatory subunit Rpn8 [346089] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346339] (9 PDB entries) |
| Domain d4ocma_: 4ocm A: [263273] Other proteins in same PDB: d4ocmb_, d4ocmc1, d4ocmc2, d4ocmc3, d4ocme_, d4ocmf1, d4ocmf2, d4ocmf3 automated match to d2o95a_ complexed with k, zn |
PDB Entry: 4ocm (more details), 1.99 Å
SCOPe Domain Sequences for d4ocma_:
Sequence, based on SEQRES records: (download)
>d4ocma_ c.97.3.1 (A:) Proteasome regulatory subunit Rpn8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedeknsd
vwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplllivd
vkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllrg
>d4ocma_ c.97.3.1 (A:) Proteasome regulatory subunit Rpn8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedeknsd
vwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplllivd
vkqqgvglptdayvaieqktflhlpctieaeeaeeigvehllrg
Timeline for d4ocma_: