Lineage for d4ocma_ (4ocm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918897Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) (S)
  5. 2918898Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins)
    Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)
  6. 2918930Protein Proteasome regulatory subunit Rpn8 [346089] (1 species)
  7. 2918931Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346339] (9 PDB entries)
  8. 2918935Domain d4ocma_: 4ocm A: [263273]
    Other proteins in same PDB: d4ocmb_, d4ocmc1, d4ocmc2, d4ocmc3, d4ocme_, d4ocmf1, d4ocmf2, d4ocmf3
    automated match to d2o95a_
    complexed with k, zn

Details for d4ocma_

PDB Entry: 4ocm (more details), 1.99 Å

PDB Description: crystal structure of the rpn8-rpn11 mpn domain heterodimer, crystal form ib
PDB Compounds: (A:) 26s proteasome regulatory subunit rpn8

SCOPe Domain Sequences for d4ocma_:

Sequence, based on SEQRES records: (download)

>d4ocma_ c.97.3.1 (A:) Proteasome regulatory subunit Rpn8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedeknsd
vwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplllivd
vkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllrg

Sequence, based on observed residues (ATOM records): (download)

>d4ocma_ c.97.3.1 (A:) Proteasome regulatory subunit Rpn8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedeknsd
vwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplllivd
vkqqgvglptdayvaieqktflhlpctieaeeaeeigvehllrg

SCOPe Domain Coordinates for d4ocma_:

Click to download the PDB-style file with coordinates for d4ocma_.
(The format of our PDB-style files is described here.)

Timeline for d4ocma_: