Lineage for d4ocla_ (4ocl A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147804Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2148136Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) (S)
  5. 2148174Family c.97.3.0: automated matches [267623] (1 protein)
    not a true family
  6. 2148175Protein automated matches [267670] (3 species)
    not a true protein
  7. 2148178Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267950] (10 PDB entries)
  8. 2148184Domain d4ocla_: 4ocl A: [263271]
    Other proteins in same PDB: d4oclc_, d4oclf_
    automated match to d2o95a_
    complexed with zn

Details for d4ocla_

PDB Entry: 4ocl (more details), 2.4 Å

PDB Description: Crystal Structure of the Rpn8-Rpn11 MPN domain heterodimer, crystal form Ia
PDB Compounds: (A:) 26s proteasome regulatory subunit rpn8

SCOPe Domain Sequences for d4ocla_:

Sequence, based on SEQRES records: (download)

>d4ocla_ c.97.3.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
hekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedeknsd
vwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplllivd
vkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllr

Sequence, based on observed residues (ATOM records): (download)

>d4ocla_ c.97.3.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
hekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedeknsd
vwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplllivd
vkqqgvglptdayvaieqktflhlpctieaeeaeeigvehllr

SCOPe Domain Coordinates for d4ocla_:

Click to download the PDB-style file with coordinates for d4ocla_.
(The format of our PDB-style files is described here.)

Timeline for d4ocla_: