| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
| Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins) contains irregular array of helices in the N-terminal extension automatically mapped to Pfam PF02211 |
| Protein automated matches [190606] (3 species) not a true protein |
| Species Pseudonocardia thermophila [TaxId:1848] [229020] (5 PDB entries) |
| Domain d4ob1b_: 4ob1 B: [263267] Other proteins in same PDB: d4ob1a_ automated match to d4ob3b_ complexed with bub, co |
PDB Entry: 4ob1 (more details), 1.63 Å
SCOPe Domain Sequences for d4ob1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ob1b_ b.34.4.4 (B:) automated matches {Pseudonocardia thermophila [TaxId: 1848]}
mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdt
Timeline for d4ob1b_: