Lineage for d4o9cg1 (4o9c G:1-270)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2918189Species Ralstonia eutropha [TaxId:381666] [261827] (3 PDB entries)
  8. 2918216Domain d4o9cg1: 4o9c G:1-270 [263262]
    automated match to d4o99a1
    complexed with coa

Details for d4o9cg1

PDB Entry: 4o9c (more details), 2 Å

PDB Description: crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16
PDB Compounds: (G:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d4o9cg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o9cg1 c.95.1.0 (G:1-270) automated matches {Ralstonia eutropha [TaxId: 381666]}
mtdvvivsaartavgkfggslakipapelgavvikaaleragvkpeqvsevimgqvltag
sgqnparqaaikaglpamvpamtinkvsgsglkavmlaanaimagdaeivvaggqenmsa
aphvlpgsrdgfrmgdaklvdtmivdglwdvynqyhmgitaenvakeygitreaqdefav
gsqnkaeaaqkagkfdeeivpvlipqrkgdpvafktdefvrqgatldsmsglkpafdkag
tvtaanasglndgaaavvvmsaakakelgl

SCOPe Domain Coordinates for d4o9cg1:

Click to download the PDB-style file with coordinates for d4o9cg1.
(The format of our PDB-style files is described here.)

Timeline for d4o9cg1: