Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (83 species) not a true protein |
Species Ralstonia eutropha [TaxId:381666] [261827] (3 PDB entries) |
Domain d4o9ce2: 4o9c E:271-393 [263261] automated match to d4o99a2 complexed with coa |
PDB Entry: 4o9c (more details), 2 Å
SCOPe Domain Sequences for d4o9ce2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o9ce2 c.95.1.0 (E:271-393) automated matches {Ralstonia eutropha [TaxId: 381666]} tplatiksyanagvdpkvmgmgpvpaskralsraewtpqdldlmeineafaaqalavhqq mgwdtskvnvnggaiaighpigasgcrilvtllhemkrrdakkglaslcigggmgvalav erk
Timeline for d4o9ce2: