SCOPe 2.08: Domain d4o9ce1: 4o9c E:1-270

Lineage for d4o9ce1 (4o9c E:1-270)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Ralstonia eutropha [TaxId:381666] [261827] (3 PDB entries)

8. Domain d4o9ce1: 4o9c E:1-270 [263260]
   automated match to d4o99a1
   complexed with coa

Details for d4o9ce1

PDB Entry: 4o9c, 2 Å

PDB Description: crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16

PDB Compounds: (E:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d4o9ce1:

Sequence; same for both SEQRES and ATOM records:

>d4o9ce1 c.95.1.0 (E:1-270) automated matches {Ralstonia eutropha [TaxId: 381666]}
mtdvvivsaartavgkfggslakipapelgavvikaaleragvkpeqvsevimgqvltag
sgqnparqaaikaglpamvpamtinkvsgsglkavmlaanaimagdaeivvaggqenmsa
aphvlpgsrdgfrmgdaklvdtmivdglwdvynqyhmgitaenvakeygitreaqdefav
gsqnkaeaaqkagkfdeeivpvlipqrkgdpvafktdefvrqgatldsmsglkpafdkag
tvtaanasglndgaaavvvmsaakakelgl

Timeline for d4o9ce1:

• d4o9ce1 first appeared in SCOPe 2.05
  
• d4o9ce1 appears in SCOPe 2.07