Lineage for d1rtf.1 (1rtf A:,B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2057401Protein Two-chain tissue plasminogen activator (TC)-T-PA [50565] (1 species)
  7. 2057402Species Human (Homo sapiens) [TaxId:9606] [50566] (2 PDB entries)
  8. 2057403Domain d1rtf.1: 1rtf A:,B: [26326]
    complexed with ben, po4

Details for d1rtf.1

PDB Entry: 1rtf (more details), 2.3 Å

PDB Description: complex of benzamidine with the catalytic domain of human two chain tissue plasminogen activator [(tc)-t-pa]
PDB Compounds: (A:) two chain tissue plasminogen activator, (B:) two chain tissue plasminogen activator

SCOPe Domain Sequences for d1rtf.1:

Sequence, based on SEQRES records: (download)

>g1rtf.1 b.47.1.2 (A:,B:) Two-chain tissue plasminogen activator (TC)-T-PA {Human (Homo sapiens) [TaxId: 9606]}
tcglrqysXikgglfadiashpwqaaifakhrrspgerflcggilisscwilsaahcfqe
rfpphhltvilgrtyrvvpgeeeqkfevekyivhkefdddtydndiallqlksdssrcaq
essvvrtvclppadlqlpdwtecelsgygkhealspfyserlkeahvrlypssrctsqhl
lnrtvtdnmlcagdtrsggpqanlhdacqgdsggplvclndgrmtlvgiiswglgcgqkd
vpgvytkvtnyldwirdnmrp

Sequence, based on observed residues (ATOM records): (download)

>g1rtf.1 b.47.1.2 (A:,B:) Two-chain tissue plasminogen activator (TC)-T-PA {Human (Homo sapiens) [TaxId: 9606]}
tcglrqysXikgglfadiashpwqaaifakhrgerflcggilisscwilsaahcfqerfp
phhltvilgrtyrvvpgeeeqkfevekyivhkefdddtydndiallqlksdssrcaqess
vvrtvclppadlqlpdwtecelsgygkhealspfyserlkeahvrlypssrctsqhllnr
tvtdnmlcagdtrsnlhdacqgdsggplvclndgrmtlvgiiswglgcgqkdvpgvytkv
tnyldwirdnmrp

SCOPe Domain Coordinates for d1rtf.1:

Click to download the PDB-style file with coordinates for d1rtf.1.
(The format of our PDB-style files is described here.)

Timeline for d1rtf.1: