Lineage for d4o8cb_ (4o8c B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920486Species Geobacillus stearothermophilus [TaxId:1422] [229821] (4 PDB entries)
  8. 2920490Domain d4o8cb_: 4o8c B: [263257]
    automated match to d4o8ca_
    complexed with mg, so4; mutant

Details for d4o8cb_

PDB Entry: 4o8c (more details), 2 Å

PDB Description: structure of the h170y mutant of thermostable p-nitrophenylphosphatase from bacillus stearothermophilus
PDB Compounds: (B:) Thermostable NPPase

SCOPe Domain Sequences for d4o8cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o8cb_ c.108.1.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mrkyngylidldgtmyrgteridaasgfikelnrlhipylfvtnnstrtpeqvadklvsl
dipatpeqiftssmatanyvydldqnamiyfigeeglykalkekgfsfadenadvvivgl
drevtyeklavaclavrngaklistngdlalptergfmpgngaftalisystqvkatfvg
kpepiimeqalkvlgtnknetimvgdnydtdilagiragldtllvhtgvttveklkeykq
qptysmkslddwkfl

SCOPe Domain Coordinates for d4o8cb_:

Click to download the PDB-style file with coordinates for d4o8cb_.
(The format of our PDB-style files is described here.)

Timeline for d4o8cb_: