Lineage for d4o6zd1 (4o6z D:1-442)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505252Species Plasmodium falciparum [TaxId:36329] [189486] (2 PDB entries)
  8. 2505257Domain d4o6zd1: 4o6z D:1-442 [263256]
    Other proteins in same PDB: d4o6za2, d4o6zb2, d4o6zd2
    automated match to d4o6za_
    complexed with plp, po4

Details for d4o6zd1

PDB Entry: 4o6z (more details), 2.98 Å

PDB Description: crystal structure of serine hydroxymethyltransferase with covalently bound plp schiff-base from plasmodium falciparum
PDB Compounds: (D:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d4o6zd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o6zd1 c.67.1.0 (D:1-442) automated matches {Plasmodium falciparum [TaxId: 36329]}
mfnndplqkydkelfdllekeknrqietinliasenltntavreclgdrisnkysegyph
kryyggndyvdkieelcykraleafnvseeewgvnvqplsgsaanvqalyalvgvkgkim
gmhlcsgghlthgffdekkkvsitsdlfesklykcnsegyvdmesvrnlalsfqpkviic
gytsyprdidykgfreicdevnaylfadishissfvacnllnnpftyadvvtttthkilr
gprsaliffnkkrnpgidqkinssvfpsfqggphnnkiaavacqlkevntpefkeytkqv
llnskalaecllkrnldlvtngtdnhlivvdlrkynitgsklqetcnainialnkntips
dvdcvspsgirigtpalttrgckekdmefiadmllkailltdelqqkygkklvdfkkglv
nnpkidelkkevvqwaknlpfa

SCOPe Domain Coordinates for d4o6zd1:

Click to download the PDB-style file with coordinates for d4o6zd1.
(The format of our PDB-style files is described here.)

Timeline for d4o6zd1: