Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (98 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [189486] (2 PDB entries) |
Domain d4o6zc_: 4o6z C: [263255] automated match to d4o6za_ complexed with plp, po4 |
PDB Entry: 4o6z (more details), 2.98 Å
SCOPe Domain Sequences for d4o6zc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o6zc_ c.67.1.0 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]} fnndplqkydkelfdllekeknrqietinliasenltntavreclgdrisnkysegyphk ryyggndyvdkieelcykraleafnvseeewgvnvqplsgsaanvqalyalvgvkgkimg mhlcsgghlthgffdekkkvsitsdlfesklykcnsegyvdmesvrnlalsfqpkviicg ytsyprdidykgfreicdevnaylfadishissfvacnllnnpftyadvvtttthkilrg prsaliffnkkrnpgidqkinssvfpsfqggphnnkiaavacqlkevntpefkeytkqvl lnskalaecllkrnldlvtngtdnhlivvdlrkynitgsklqetcnainialnkntipsd vdcvspsgirigtpalttrgckekdmefiadmllkailltdelqqkygkklvdfkkglvn npkidelkkevvqwaknlpfa
Timeline for d4o6zc_: